PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy014131
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 165aa    MW: 17694 Da    PI: 5.8913
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59546276PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS130.71.6e-40161642144
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvs.elykalppsetsekn...sseelaalkl..fsevsPilkfsh 95 
                ++lL++cA+a++++d +laq++L+ l+++a pdgd++qRla  f++AL ar a+++s ++ +a++  ++++++   +++++++ +l  f++++P+++f++
  Ahy014131  16 EQLLVHCANAIETNDVTLAQQILWVLNNIAPPDGDSNQRLAGSFLRALTARAANTGScKMLAAVADAAANRNSlaiETHRFSVIELanFVDLTPWHRFGF 115
                79***************************************************94331444455555555455566556666666699************ PP

       GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRi 144
                 +aN aIlea+eg + +Hi+D+++++++Q p+L++a+a R e pp +++
  Ahy014131 116 TAANAAILEATEGFSVIHIVDLSLTHCMQIPTLIDAIAGRHEVPPVIKL 164
                *********************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098526.4291165IPR005202Transcription factor GRAS
PfamPF035145.7E-3816164IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
KSLPTSTTFG DATCMEQLLV HCANAIETND VTLAQQILWV LNNIAPPDGD SNQRLAGSFL  60
RALTARAANT GSCKMLAAVA DAAANRNSLA IETHRFSVIE LANFVDLTPW HRFGFTAANA  120
AILEATEGFS VIHIVDLSLT HCMQIPTLID AIAGRHEVPP VIKLX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015963847.11e-113PREDICTED: scarecrow-like protein 32
SwissprotQ9SN222e-63SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A0L9TPK72e-93A0A0L9TPK7_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R4U03e-93A0A0S3R4U0_PHAAN; Uncharacterized protein
TrEMBLA0A151SK841e-93A0A151SK84_CAJCA; Scarecrow-like protein 32
STRINGGLYMA05G22140.11e-86(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.14e-64GRAS family protein